Brand: | Abnova |
Reference: | H00002739-M01 |
Product name: | GLO1 monoclonal antibody (M01), clone 4C12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GLO1. |
Clone: | 4C12 |
Isotype: | IgG2b Kappa |
Gene id: | 2739 |
Gene name: | GLO1 |
Gene alias: | GLOD1|GLYI |
Gene description: | glyoxalase I |
Genbank accession: | BC011365 |
Immunogen: | GLO1 (AAH11365.1, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAEPQPPSGGLTDEAALSYCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKAT |
Protein accession: | AAH11365.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged GLO1 is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |