Brand: | Abnova |
Reference: | H00002737-M04 |
Product name: | GLI3 monoclonal antibody (M04), clone 1H7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GLI3. |
Clone: | 1H7 |
Isotype: | IgG2b Kappa |
Gene id: | 2737 |
Gene name: | GLI3 |
Gene alias: | ACLS|GCPS|PAP-A|PAPA|PAPA1|PAPB|PHS|PPDIV |
Gene description: | GLI-Kruppel family member GLI3 |
Genbank accession: | NM_000168 |
Immunogen: | GLI3 (NP_000159, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEAQSHSSTTTEKKKVENSIVKCSTRTDVSEKAVASSTTSNEDESPGQTYHRERRNAITMQPQNVQGLSKVSEEPSTSSDERASLIKKEIHGSLPHVAEPSVPYRGTVFA |
Protein accession: | NP_000159 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged GLI3 is 3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |