No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse,Rat |
Host species | Mouse |
Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00002729-M01 |
Product name: | GCLC monoclonal antibody (M01), clone 3H1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GCLC. |
Clone: | 3H1 |
Isotype: | IgG1 Kappa |
Gene id: | 2729 |
Gene name: | GCLC |
Gene alias: | GCS|GLCL|GLCLC |
Gene description: | glutamate-cysteine ligase, catalytic subunit |
Genbank accession: | NM_001498 |
Immunogen: | GCLC (NP_001489, 528 a.a. ~ 637 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EGVFPGLIPILNSYLENMEVDVDTRCSILNYLKLIKKRASGELMTVARWMREFIANHPDYKQDSVITDEMNYSLILKCNQIANELCECPELLGSAFRKVKYSGSKTDSSN |
Protein accession: | NP_001489 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![]() |
Application image note: | Immunofluorescence of monoclonal antibody to GCLC on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Glycogen Synthase Kinase 3 Regulates Cell Death and Survival Signaling in Tumor Cells under Redox Stress.Vene R, Cardinali B, Arena G, Ferrari N, Benelli R, Minghelli S, Poggi A, Noonan DM, Albini A, Tosetti F Neoplasia. 2014 Sep;16(9):710-22. doi: 10.1016/j.neo.2014.07.012. |