| Brand: | Abnova |
| Reference: | H00002729-M01 |
| Product name: | GCLC monoclonal antibody (M01), clone 3H1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GCLC. |
| Clone: | 3H1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2729 |
| Gene name: | GCLC |
| Gene alias: | GCS|GLCL|GLCLC |
| Gene description: | glutamate-cysteine ligase, catalytic subunit |
| Genbank accession: | NM_001498 |
| Immunogen: | GCLC (NP_001489, 528 a.a. ~ 637 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EGVFPGLIPILNSYLENMEVDVDTRCSILNYLKLIKKRASGELMTVARWMREFIANHPDYKQDSVITDEMNYSLILKCNQIANELCECPELLGSAFRKVKYSGSKTDSSN |
| Protein accession: | NP_001489 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to GCLC on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Glycogen Synthase Kinase 3 Regulates Cell Death and Survival Signaling in Tumor Cells under Redox Stress.Vene R, Cardinali B, Arena G, Ferrari N, Benelli R, Minghelli S, Poggi A, Noonan DM, Albini A, Tosetti F Neoplasia. 2014 Sep;16(9):710-22. doi: 10.1016/j.neo.2014.07.012. |