Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GCLC polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about GCLC polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00002729-A01 |
| Product name: | GCLC polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant GCLC. |
| Gene id: | 2729 |
| Gene name: | GCLC |
| Gene alias: | GCS|GLCL|GLCLC |
| Gene description: | glutamate-cysteine ligase, catalytic subunit |
| Genbank accession: | NM_001498 |
| Immunogen: | GCLC (NP_001489, 528 a.a. ~ 637 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | EGVFPGLIPILNSYLENMEVDVDTRCSILNYLKLIKKRASGELMTVARWMREFIANHPDYKQDSVITDEMNYSLILKCNQIANELCECPELLGSAFRKVKYSGSKTDSSN |
| Protein accession: | NP_001489 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |