Cart 29 Product Products 9 187,79 € (empty)
-
-
-
-
-
-
-
-
-
-
1 x eIF3α...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
9 187,79 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 29 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 9 187,79 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 9 187,79 €
Data sheet of GK purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,IHC-P,WB-Tr |
More info about GK purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00002710-B01P |
| Product name: | GK purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human GK protein. |
| Gene id: | 2710 |
| Gene name: | GK |
| Gene alias: | GK1|GKD |
| Gene description: | glycerol kinase |
| Genbank accession: | NM_000167.3 |
| Immunogen: | GK (NP_000158.1, 1 a.a. ~ 524 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKITGEPLYNAVVWLDLRTQSTVESLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEKRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKQLCEFFGIPMEILPNVRSSSEIYGLMKAGALEGVPISGCLGDQSAALVGQMCFQIGQAKNTYGTGCFLLCNTGHKCVFSDHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSPESGIP |
| Protein accession: | NP_000158.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of GK expression in transfected 293T cell line (H00002710-T01) by GK MaxPab polyclonal antibody. Lane 1: GK transfected lysate(57.64 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,IHC-P,WB-Tr |
| Shipping condition: | Dry Ice |