Brand: | Abnova |
Reference: | H00002710-A01 |
Product name: | GK polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant GK. |
Gene id: | 2710 |
Gene name: | GK |
Gene alias: | GK1|GKD |
Gene description: | glycerol kinase |
Genbank accession: | NM_000167 |
Immunogen: | GK (NP_000158, 2 a.a. ~ 94 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | AASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQR |
Protein accession: | NP_000158 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.34 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | GK polyclonal antibody (A01), Lot # 051214JC01. Western Blot analysis of GK expression in human ovarian cancer. |
Applications: | WB-Ti,ELISA,WB-Re |
Shipping condition: | Dry Ice |