No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
| Brand: | Abnova |
| Reference: | H00002705-M08 |
| Product name: | GJB1 monoclonal antibody (M08), clone 1F5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GJB1. |
| Clone: | 1F5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2705 |
| Gene name: | GJB1 |
| Gene alias: | CMTX|CMTX1|CX32 |
| Gene description: | gap junction protein, beta 1, 32kDa |
| Genbank accession: | BC022426 |
| Immunogen: | GJB1 (AAH22426, 75 a.a. ~ 174 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RLWSLQLILVSTPALLVAMHVAHQQHIEKKMLRLEGHGDPLHLEEVKRHKVHISGTLWWTYVISVVFRLLFEAVFMYVFYLLYPGYAMVRLVKCDVYPCP |
| Protein accession: | AAH22426 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Detection limit for recombinant GST tagged GJB1 is approximately 1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |