No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00002697-M01 |
| Product name: | GJA1 monoclonal antibody (M01), clone 3E5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GJA1. |
| Clone: | 3E5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2697 |
| Gene name: | GJA1 |
| Gene alias: | CX43|DFNB38|GJAL|ODDD |
| Gene description: | gap junction protein, alpha 1, 43kDa |
| Genbank accession: | BC026329 |
| Immunogen: | GJA1 (AAH26329, 261 a.a. ~ 361 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVD* |
| Protein accession: | AAH26329 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | GJA1 monoclonal antibody (M01), clone 3E5. Western Blot analysis of GJA1 expression in human placenta. |
| Applications: | WB-Ti,ELISA,WB-Re |
| Shipping condition: | Dry Ice |