No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,S-ELISA,ELISA,IP |
Brand: | Abnova |
Reference: | H00002694-M03 |
Product name: | GIF monoclonal antibody (M03), clone 1D9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GIF. |
Clone: | 1D9 |
Isotype: | IgG2a Kappa |
Gene id: | 2694 |
Gene name: | GIF |
Gene alias: | IF|IFMH|INF|TCN3 |
Gene description: | gastric intrinsic factor (vitamin B synthesis) |
Genbank accession: | NM_005142 |
Immunogen: | GIF (NP_005133.2, 318 a.a. ~ 417 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | INNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY |
Protein accession: | NP_005133.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged GIF is approximately 0.3ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,IP |
Shipping condition: | Dry Ice |