Cart 39 Product Products 13 379,66 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Smad3...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
13 379,66 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 39 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 13 379,66 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 13 379,66 €
Data sheet of GIF purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Rabbit |
| Applications | WB-Ti,WB-Tr |
More info about GIF purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00002694-D01P |
| Product name: | GIF purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human GIF protein. |
| Gene id: | 2694 |
| Gene name: | GIF |
| Gene alias: | IF|IFMH|INF|TCN3 |
| Gene description: | gastric intrinsic factor (vitamin B synthesis) |
| Genbank accession: | NM_005142.2 |
| Immunogen: | GIF (NP_005133.2, 1 a.a. ~ 417 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAWFALYLLSLLWATAGTSTQTQSSCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPSNPGPGPTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY |
| Protein accession: | NP_005133.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | GIF MaxPab rabbit polyclonal antibody. Western Blot analysis of GIF expression in mouse stomach. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Epithelial BMP signaling is required for proper specification of epithelial cell lineages and gastric endocrine cells.Maloum F, Allaire JM, Gagne-Sansfacon J, Roy E, Belleville K, Sarret P, Morisset J, Carrier JC, Mishina Y, Kaestner KH, Perreault N. Am J Physiol Gastrointest Liver Physiol. 2011 Mar 17. [Epub ahead of print] |