GH1 purified MaxPab rabbit polyclonal antibody (D01P) View larger

GH1 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GH1 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about GH1 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00002688-D01P
Product name: GH1 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human GH1 protein.
Gene id: 2688
Gene name: GH1
Gene alias: GH|GH-N|GHN|hGH-N
Gene description: growth hormone 1
Genbank accession: NM_000515
Immunogen: GH1 (AAH75012.1, 1 a.a. ~ 217 a.a) full-length human protein.
Immunogen sequence/protein sequence: MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Protein accession: AAH75012.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00002688-D01P-13-15-1.jpg
Application image note: Western Blot analysis of GH1 expression in transfected 293T cell line (H00002688-T01) by GH1 MaxPab polyclonal antibody.

Lane 1: GH1 transfected lysate(24.80 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GH1 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart