No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,IP |
| Brand: | Abnova |
| Reference: | H00002678-M01 |
| Product name: | GGT1 monoclonal antibody (M01), clone 1F9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GGT1. |
| Clone: | 1F9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2678 |
| Gene name: | GGT1 |
| Gene alias: | CD224|D22S672|D22S732|GGT|GTG|MGC96892|MGC96904|MGC96963 |
| Gene description: | gamma-glutamyltransferase 1 |
| Genbank accession: | NM_005265 |
| Immunogen: | GGT1 (NP_005256, 381 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVG |
| Protein accession: | NP_005256 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: | ![]() |
| Application image note: | Immunoperoxidase of monoclonal antibody to GGT1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,IP |
| Shipping condition: | Dry Ice |
| Publications: | Polymorphisms in ABCB11 and ATP8B1 Associated with Development of Severe Intrahepatic Cholestasis in Hodgkin's Lymphoma.Blackmore L, Knisely AS, Hartley JL, McKay K, Gissen P, Marcus R, Shawcross DL. Journal of Clinical and Experimental Hepatology (2012), http://dx.doi.org/10.1016/j.jceh.2013.01.005 |