| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00002674-M11 |
| Product name: | GFRA1 monoclonal antibody (M11), clone 3D8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GFRA1. |
| Clone: | 3D8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2674 |
| Gene name: | GFRA1 |
| Gene alias: | GDNFR|GDNFRA|GFR-ALPHA-1|MGC23045|RET1L|RETL1|TRNR1 |
| Gene description: | GDNF family receptor alpha 1 |
| Genbank accession: | NM_005264 |
| Immunogen: | GFRA1 (NP_005255, 32 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ASDQCLKEQSCSTKYRTLRQCVAGKETNFSLASGLEAKDECRSAMEALKQKSLYNCRCKRGMKKEKNCLRIYWSMYQSLQGNDLLEDS |
| Protein accession: | NP_005255 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.68 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of GFRA1 expression in transfected 293T cell line by GFRA1 monoclonal antibody (M11), clone 3D8. Lane 1: GFRA1 transfected lysate(50.8 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |