GDF2 polyclonal antibody (A01) View larger

GDF2 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GDF2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about GDF2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00002658-A01
Product name: GDF2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant GDF2.
Gene id: 2658
Gene name: GDF2
Gene alias: BMP-9|BMP9
Gene description: growth differentiation factor 2
Genbank accession: NM_016204
Immunogen: GDF2 (NP_057288, 320 a.a. ~ 419 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: SAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYE
Protein accession: NP_057288
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002658-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002658-A01-1-75-1.jpg
Application image note: GDF2 polyclonal antibody (A01), Lot # 051012JC01. Western Blot analysis of GDF2 expression in Daoy.
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GDF2 polyclonal antibody (A01) now

Add to cart