NR6A1 (Human) Recombinant Protein (Q01) View larger

NR6A1 (Human) Recombinant Protein (Q01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NR6A1 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about NR6A1 (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00002649-Q01
Product name: NR6A1 (Human) Recombinant Protein (Q01)
Product description: Human NR6A1 partial ORF ( NP_001480, 366 a.a. - 474 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 2649
Gene name: NR6A1
Gene alias: GCNF|GCNF1|NR61|RTR
Gene description: nuclear receptor subfamily 6, group A, member 1
Genbank accession: NM_001489
Immunogen sequence/protein sequence: RLIYLYHKFHQLKVSNEEYACMKAINFLNQDIRGLTSASQLEQLNKRYWYICQDFTEYKYTHQPNRFPDLMMCLPEIRYIAGKMVNVPLEQLPLLFKVVLHSCKTSVGK
Protein accession: NP_001480
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00002649-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Related products: - GCNT1 (Human) Recombinant Protein (P01)
- GCNT2 (Human) Recombinant Protein (P01)
- GCNT2 (Human) Recombinant Protein (Q01)
- OPN1MW (Human) Recombinant Protein
- GCSH (Human) Recombinant Protein (P01)
Shipping condition: Dry Ice

Buy NR6A1 (Human) Recombinant Protein (Q01) now

Add to cart