NR6A1 polyclonal antibody (A01) View larger

NR6A1 polyclonal antibody (A01)

New product

286,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NR6A1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about NR6A1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00002649-A01
Product name: NR6A1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant NR6A1.
Gene id: 2649
Gene name: NR6A1
Gene alias: GCNF|GCNF1|NR61|RTR
Gene description: nuclear receptor subfamily 6, group A, member 1
Genbank accession: NM_001489
Immunogen: NR6A1 (NP_001480, 366 a.a. ~ 474 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: RLIYLYHKFHQLKVSNEEYACMKAINFLNQDIRGLTSASQLEQLNKRYWYICQDFTEYKYTHQPNRFPDLMMCLPEIRYIAGKMVNVPLEQLPLLFKVVLHSCKTSVGK
Protein accession: NP_001480
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002649-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.1 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Related products: - NR6A1 MaxPab mouse polyclonal antibody (B01)
- NR6A1 purified MaxPab mouse polyclonal antibody (B01P)
- NR6A1 MaxPab rabbit polyclonal antibody (D01)
- NR6A1 purified MaxPab rabbit polyclonal antibody (D01P)
- GCNT1 purified MaxPab mouse polyclonal antibody (B01P)
Shipping condition: Dry Ice

Buy NR6A1 polyclonal antibody (A01) now

Add to cart