Login to display prices
Login to display prices
GCN5L2 (Human) Recombinant Protein (Q01) View larger

GCN5L2 (Human) Recombinant Protein (Q01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GCN5L2 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Origin speciesHuman
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about GCN5L2 (Human) Recombinant Protein (Q01)

Reference: H00002648-Q01
Product name: GCN5L2 (Human) Recombinant Protein (Q01)
Product description: Human GCN5L2 partial ORF ( AAH32743, 738 a.a. - 837 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 2648
Gene name: KAT2A
Gene alias: GCN5|GCN5L2|MGC102791|PCAF-b|hGCN5
Gene description: K(lysine) acetyltransferase 2A
Genbank accession: BC032743
Immunogen sequence/protein sequence: KNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
Protein accession: AAH32743
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Shipping condition: Dry Ice

30 other products in the same category: