Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GCN5L2 monoclonal antibody (M06), clone 3F8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,WB-Ti,IHC-P,ELISA |
More info about GCN5L2 monoclonal antibody (M06), clone 3F8
| Brand: | Abnova |
| Reference: | H00002648-M06 |
| Product name: | GCN5L2 monoclonal antibody (M06), clone 3F8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GCN5L2. |
| Clone: | 3F8 |
| Isotype: | IgG2b Kappa |
| Gene id: | 2648 |
| Gene name: | KAT2A |
| Gene alias: | GCN5|GCN5L2|MGC102791|PCAF-b|hGCN5 |
| Gene description: | K(lysine) acetyltransferase 2A |
| Genbank accession: | BC032743 |
| Immunogen: | GCN5L2 (AAH32743, 738 a.a. ~ 837 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK |
| Protein accession: | AAH32743 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | GCN5L2 monoclonal antibody (M06), clone 3F8. Western Blot analysis of GCN5L2 expression in RIN-m5F. |
| Applications: | WB-Ce,WB-Ti,IHC-P,ELISA |
| Shipping condition: | Dry Ice |