GCN5L2 monoclonal antibody (M06), clone 3F8 View larger

GCN5L2 monoclonal antibody (M06), clone 3F8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GCN5L2 monoclonal antibody (M06), clone 3F8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,IHC-P,ELISA

More info about GCN5L2 monoclonal antibody (M06), clone 3F8

Brand: Abnova
Reference: H00002648-M06
Product name: GCN5L2 monoclonal antibody (M06), clone 3F8
Product description: Mouse monoclonal antibody raised against a partial recombinant GCN5L2.
Clone: 3F8
Isotype: IgG2b Kappa
Gene id: 2648
Gene name: KAT2A
Gene alias: GCN5|GCN5L2|MGC102791|PCAF-b|hGCN5
Gene description: K(lysine) acetyltransferase 2A
Genbank accession: BC032743
Immunogen: GCN5L2 (AAH32743, 738 a.a. ~ 837 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
Protein accession: AAH32743
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00002648-M06-1-68-1.jpg
Application image note: GCN5L2 monoclonal antibody (M06), clone 3F8. Western Blot analysis of GCN5L2 expression in RIN-m5F.
Applications: WB-Ce,WB-Ti,IHC-P,ELISA
Related products: - GCSH monoclonal antibody (M01), clone 3D8-A12
- GCSH monoclonal antibody (M02), clone M2
- GDF2 monoclonal antibody (M01), clone 4D2
- GDF8 monoclonal antibody (M06), clone 2D8
- GDF8 monoclonal antibody (M07), clone 3E7
Shipping condition: Dry Ice

Buy GCN5L2 monoclonal antibody (M06), clone 3F8 now

Add to cart