GCN5L2 monoclonal antibody (M03), clone 4F9 View larger

GCN5L2 monoclonal antibody (M03), clone 4F9

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GCN5L2 monoclonal antibody (M03), clone 4F9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about GCN5L2 monoclonal antibody (M03), clone 4F9

Brand: Abnova
Reference: H00002648-M03
Product name: GCN5L2 monoclonal antibody (M03), clone 4F9
Product description: Mouse monoclonal antibody raised against a partial recombinant GCN5L2.
Clone: 4F9
Isotype: IgG2a Kappa
Gene id: 2648
Gene name: KAT2A
Gene alias: GCN5|GCN5L2|MGC102791|PCAF-b|hGCN5
Gene description: K(lysine) acetyltransferase 2A
Genbank accession: BC032743
Immunogen: GCN5L2 (AAH32743, 738 a.a. ~ 837 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
Protein accession: AAH32743
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002648-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002648-M03-1-7-1.jpg
Application image note: GCN5L2 monoclonal antibody (M03), clone 4F9 Western Blot analysis of GCN5L2 expression in MCF-7 ( Cat # L046V1 ).
Applications: WB-Ce,ELISA,WB-Re
Related products: - GCN5L2 monoclonal antibody (M06), clone 3F8
- GCSH monoclonal antibody (M01), clone 3D8-A12
- GCSH monoclonal antibody (M02), clone M2
- GDF2 monoclonal antibody (M01), clone 4D2
- GDF8 monoclonal antibody (M06), clone 2D8
Shipping condition: Dry Ice

Buy GCN5L2 monoclonal antibody (M03), clone 4F9 now

Add to cart