Login to display prices
Login to display prices
GCN5L2 monoclonal antibody (M01), clone 4D3 View larger

GCN5L2 monoclonal antibody (M01), clone 4D3

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GCN5L2 monoclonal antibody (M01), clone 4D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsWB-Ce,IF,ELISA,WB-Re

More info about GCN5L2 monoclonal antibody (M01), clone 4D3

Reference: H00002648-M01
Product name: GCN5L2 monoclonal antibody (M01), clone 4D3
Product description: Mouse monoclonal antibody raised against a partial recombinant GCN5L2.
Clone: 4D3
Isotype: IgG2b Kappa
Gene id: 2648
Gene name: KAT2A
Gene alias: GCN5|GCN5L2|MGC102791|PCAF-b|hGCN5
Gene description: K(lysine) acetyltransferase 2A
Genbank accession: BC032743
Immunogen: GCN5L2 (AAH32743, 738 a.a. ~ 837 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
Protein accession: AAH32743
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: