BLOC1S1 (Human) Recombinant Protein (Q01) View larger

BLOC1S1 (Human) Recombinant Protein (Q01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BLOC1S1 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about BLOC1S1 (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00002647-Q01
Product name: BLOC1S1 (Human) Recombinant Protein (Q01)
Product description: Human BLOC1S1 partial ORF ( NP_001478, 31 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 2647
Gene name: BLOC1S1
Gene alias: BLOS1|FLJ39337|FLJ97089|GCN5L1|MGC87455|MICoA|RT14
Gene description: biogenesis of lysosomal organelles complex-1, subunit 1
Genbank accession: NM_001487
Immunogen sequence/protein sequence: ATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAP
Protein accession: NP_001478
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00002647-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Related products: - GCN5L2 (Human) Recombinant Protein (Q01)
- KAT2A (Human) Recombinant Protein (Q02)
- NR6A1 (Human) Recombinant Protein (P01)
- NR6A1 (Human) Recombinant Protein (Q01)
- GCNT1 (Human) Recombinant Protein (P01)
Shipping condition: Dry Ice

Buy BLOC1S1 (Human) Recombinant Protein (Q01) now

Add to cart