Login to display prices
Login to display prices
GCHFR (Human) Recombinant Protein (P01) View larger

GCHFR (Human) Recombinant Protein (P01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GCHFR (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Origin speciesHuman
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about GCHFR (Human) Recombinant Protein (P01)

Reference: H00002644-P01
Product name: GCHFR (Human) Recombinant Protein (P01)
Product description: Human GCHFR full-length ORF ( NP_005249.1, 1 a.a. - 84 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 2644
Gene name: GCHFR
Gene alias: GFRP|HsT16933|MGC138467|MGC138469|P35
Gene description: GTP cyclohydrolase I feedback regulator
Genbank accession: NM_005258.2
Immunogen sequence/protein sequence: MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE
Protein accession: NP_005249.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Shipping condition: Dry Ice

30 other products in the same category: