Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GCHFR purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
More info about GCHFR purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00002644-D01P |
| Product name: | GCHFR purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human GCHFR protein. |
| Gene id: | 2644 |
| Gene name: | GCHFR |
| Gene alias: | GFRP|HsT16933|MGC138467|MGC138469|P35 |
| Gene description: | GTP cyclohydrolase I feedback regulator |
| Genbank accession: | NM_005258 |
| Immunogen: | GCHFR (NP_005249.1, 1 a.a. ~ 84 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE |
| Protein accession: | NP_005249.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of GCHFR expression in transfected 293T cell line (H00002644-T02) by GCHFR MaxPab polyclonal antibody. Lane 1: GCHFR transfected lysate(9.70 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | The Protein Partners of GTP Cyclohydrolase I in Rat Organs.Du J, Teng RJ, Lawrence M, Guan T, Xu H, Ge Y, Shi Y. PLoS One. 2012;7(3):e33991. Epub 2012 Mar 27. |