Login to display prices
Login to display prices
GCHFR purified MaxPab rabbit polyclonal antibody (D01P) View larger

GCHFR purified MaxPab rabbit polyclonal antibody (D01P)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GCHFR purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesRabbit
ApplicationsWB-Tr

More info about GCHFR purified MaxPab rabbit polyclonal antibody (D01P)

Reference: H00002644-D01P
Product name: GCHFR purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human GCHFR protein.
Gene id: 2644
Gene name: GCHFR
Gene alias: GFRP|HsT16933|MGC138467|MGC138469|P35
Gene description: GTP cyclohydrolase I feedback regulator
Genbank accession: NM_005258
Immunogen: GCHFR (NP_005249.1, 1 a.a. ~ 84 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE
Protein accession: NP_005249.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Shipping condition: Dry Ice

30 other products in the same category: