GCHFR purified MaxPab rabbit polyclonal antibody (D01P) View larger

GCHFR purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GCHFR purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about GCHFR purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00002644-D01P
Product name: GCHFR purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human GCHFR protein.
Gene id: 2644
Gene name: GCHFR
Gene alias: GFRP|HsT16933|MGC138467|MGC138469|P35
Gene description: GTP cyclohydrolase I feedback regulator
Genbank accession: NM_005258
Immunogen: GCHFR (NP_005249.1, 1 a.a. ~ 84 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE
Protein accession: NP_005249.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00002644-D01P-13-15-1.jpg
Application image note: Western Blot analysis of GCHFR expression in transfected 293T cell line (H00002644-T02) by GCHFR MaxPab polyclonal antibody.

Lane 1: GCHFR transfected lysate(9.70 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Related products: - GCK purified MaxPab mouse polyclonal antibody (B01P)
- GCK purified MaxPab mouse polyclonal antibody (B02P)
- GCK purified MaxPab rabbit polyclonal antibody (D01P)
- NR6A1 polyclonal antibody (A01)
- NR6A1 MaxPab mouse polyclonal antibody (B01)
Shipping condition: Dry Ice
Publications: The Protein Partners of GTP Cyclohydrolase I in Rat Organs.Du J, Teng RJ, Lawrence M, Guan T, Xu H, Ge Y, Shi Y.
PLoS One. 2012;7(3):e33991. Epub 2012 Mar 27.

Buy GCHFR purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart