GCH1 (Human) Recombinant Protein (Q01) View larger

GCH1 (Human) Recombinant Protein (Q01)

New product

527,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GCH1 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about GCH1 (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00002643-Q01
Product name: GCH1 (Human) Recombinant Protein (Q01)
Product description: Human GCH1 partial ORF ( NP_000152, 84 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 2643
Gene name: GCH1
Gene alias: DYT14|DYT5|GCH|GTP-CH-1|GTPCH1
Gene description: GTP cyclohydrolase 1
Genbank accession: NM_000161
Immunogen sequence/protein sequence: ENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIV
Protein accession: NP_000152
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00002643-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Related products: - GCHFR (Human) Recombinant Protein (P01)
- GCHFR (Human) Recombinant Protein (Q01)
- GCK (Human) Recombinant Protein (P01)
- GCK (Human) Recombinant Protein (Q01)
- BLOC1S1 (Human) Recombinant Protein (P01)
Shipping condition: Dry Ice

Buy GCH1 (Human) Recombinant Protein (Q01) now

Add to cart