Brand | Abnova |
Product type | Proteins |
Host species | Wheat Germ (in vitro) |
Applications | AP,Array,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00002643-P01 |
Product name: | GCH1 (Human) Recombinant Protein (P01) |
Product description: | Human GCH1 full-length ORF ( AAH25415.1, 1 a.a. - 250 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 2643 |
Gene name: | GCH1 |
Gene alias: | DYT14|DYT5|GCH|GTP-CH-1|GTPCH1 |
Gene description: | GTP cyclohydrolase 1 |
Genbank accession: | BC025415 |
Immunogen sequence/protein sequence: | MEKGPVRAPAEKPRGARCSNGFPERDPPRPGPSRPAEKPPRPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS |
Protein accession: | AAH25415.1 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: | ![]() |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Related products: | - GCH1 (Human) Recombinant Protein (Q01) - GCHFR (Human) Recombinant Protein (P01) - GCHFR (Human) Recombinant Protein (Q01) - GCK (Human) Recombinant Protein (P01) - GCK (Human) Recombinant Protein (Q01) |
Shipping condition: | Dry Ice |
Publications: | Regulation of Tetrahydrobiopterin Biosynthesis by Shear Stress.Widder JD, Chen W, Li L, Dikalov S, Thony B, Hatakeyama K, Harrison DG. Circ Res. 2007 Oct 12;101(8):830-8. Epub 2007 Aug 17. |