Login to display prices
Login to display prices
GCH1 monoclonal antibody (M03), clone 1F5 View larger

GCH1 monoclonal antibody (M03), clone 1F5

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GCH1 monoclonal antibody (M03), clone 1F5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA

More info about GCH1 monoclonal antibody (M03), clone 1F5

Reference: H00002643-M03
Product name: GCH1 monoclonal antibody (M03), clone 1F5
Product description: Mouse monoclonal antibody raised against a full length recombinant GCH1.
Clone: 1F5
Isotype: IgG2b Kappa
Gene id: 2643
Gene name: GCH1
Gene alias: DYT14|DYT5|GCH|GTP-CH-1|GTPCH1
Gene description: GTP cyclohydrolase 1
Genbank accession: BC025415
Immunogen: GCH1 (AAH25415.1, 1 a.a. ~ 250 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEKGPVRAPAEKPRGARCSNGFPERDPPRPGPSRPAEKPPRPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS
Protein accession: AAH25415.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: