GCH1 monoclonal antibody (M02), clone 2C4 View larger

GCH1 monoclonal antibody (M02), clone 2C4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GCH1 monoclonal antibody (M02), clone 2C4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA

More info about GCH1 monoclonal antibody (M02), clone 2C4

Brand: Abnova
Reference: H00002643-M02
Product name: GCH1 monoclonal antibody (M02), clone 2C4
Product description: Mouse monoclonal antibody raised against a full length recombinant GCH1.
Clone: 2C4
Isotype: IgG1 Kappa
Gene id: 2643
Gene name: GCH1
Gene alias: DYT14|DYT5|GCH|GTP-CH-1|GTPCH1
Gene description: GTP cyclohydrolase 1
Genbank accession: BC025415
Immunogen: GCH1 (AAH25415.1, 1 a.a. ~ 250 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEKGPVRAPAEKPRGARCSNGFPERDPPRPGPSRPAEKPPRPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS
Protein accession: AAH25415.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002643-M02-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged GCH1 is approximately 0.1ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA
Related products: - GCH1 monoclonal antibody (M03), clone 1F5
- GCHFR monoclonal antibody (M01), clone 4G6
- GCK monoclonal antibody (M01), clone 3C7
- GCK monoclonal antibody (M02), clone 1G10
- GCN5L2 monoclonal antibody (M01), clone 4D3
Shipping condition: Dry Ice

Buy GCH1 monoclonal antibody (M02), clone 2C4 now

Add to cart