GCH1 monoclonal antibody (M01), clone 4A12 View larger

GCH1 monoclonal antibody (M01), clone 4A12

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GCH1 monoclonal antibody (M01), clone 4A12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP

More info about GCH1 monoclonal antibody (M01), clone 4A12

Brand: Abnova
Reference: H00002643-M01
Product name: GCH1 monoclonal antibody (M01), clone 4A12
Product description: Mouse monoclonal antibody raised against a partial recombinant GCH1.
Clone: 4A12
Isotype: IgG2a Kappa
Gene id: 2643
Gene name: GCH1
Gene alias: DYT14|DYT5|GCH|GTP-CH-1|GTPCH1
Gene description: GTP cyclohydrolase 1
Genbank accession: NM_000161
Immunogen: GCH1 (NP_000152, 84 a.a. ~ 172 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIV
Protein accession: NP_000152
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002643-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002643-M01-3-10-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to GCH1 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP
Related products: - GCH1 monoclonal antibody (M02), clone 2C4
- GCH1 monoclonal antibody (M03), clone 1F5
- GCHFR monoclonal antibody (M01), clone 4G6
- GCK monoclonal antibody (M01), clone 3C7
- GCK monoclonal antibody (M02), clone 1G10
Shipping condition: Dry Ice
Publications: Inflammatory Monocytes Determine Endothelial Nitric Oxide Synthase Uncoupling and Nitro-oxidative Stress Induced by Angiotensin II.Kossmann S, Hu H, Steven S, Schonfelder T, Fraccarollo D, Mikhed Y, Brahler M, Knorr M, Brandt M, Karbach SH, Becker C, Oelze M, Bauersachs J, Widder J, Munzel T, Daiber A, Wenzel P
J Biol Chem. 2014 Aug 20. pii: jbc.M114.604231.

Buy GCH1 monoclonal antibody (M01), clone 4A12 now

Add to cart