Login to display prices
Login to display prices
GCH1 monoclonal antibody (M01), clone 4A12 View larger

GCH1 monoclonal antibody (M01), clone 4A12

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GCH1 monoclonal antibody (M01), clone 4A12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP

More info about GCH1 monoclonal antibody (M01), clone 4A12

Reference: H00002643-M01
Product name: GCH1 monoclonal antibody (M01), clone 4A12
Product description: Mouse monoclonal antibody raised against a partial recombinant GCH1.
Clone: 4A12
Isotype: IgG2a Kappa
Gene id: 2643
Gene name: GCH1
Gene alias: DYT14|DYT5|GCH|GTP-CH-1|GTPCH1
Gene description: GTP cyclohydrolase 1
Genbank accession: NM_000161
Immunogen: GCH1 (NP_000152, 84 a.a. ~ 172 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIV
Protein accession: NP_000152
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: