Login to display prices
Login to display prices
GCH1 purified MaxPab rabbit polyclonal antibody (D01P) View larger

GCH1 purified MaxPab rabbit polyclonal antibody (D01P)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GCH1 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesRabbit
ApplicationsWB-Tr

More info about GCH1 purified MaxPab rabbit polyclonal antibody (D01P)

Reference: H00002643-D01P
Product name: GCH1 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human GCH1 protein.
Gene id: 2643
Gene name: GCH1
Gene alias: DYT14|DYT5|GCH|GTP-CH-1|GTPCH1
Gene description: GTP cyclohydrolase 1
Genbank accession: NM_000161.2
Immunogen: GCH1 (NP_000152.1, 1 a.a. ~ 250 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEKGPVRAPAEKPRGARCSNGFPERDPPRPGPSRPAEKPPRPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS
Protein accession: NP_000152.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Shipping condition: Dry Ice

30 other products in the same category: