GCH1 polyclonal antibody (A02) View larger

GCH1 polyclonal antibody (A02)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GCH1 polyclonal antibody (A02)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about GCH1 polyclonal antibody (A02)

Brand: Abnova
Reference: H00002643-A02
Product name: GCH1 polyclonal antibody (A02)
Product description: Mouse polyclonal antibody raised against a full-length recombinant GCH1.
Gene id: 2643
Gene name: GCH1
Gene alias: DYT14|DYT5|GCH|GTP-CH-1|GTPCH1
Gene description: GTP cyclohydrolase 1
Genbank accession: BC025415
Immunogen: GCH1 (AAH25415.1, 1 a.a. ~ 250 a.a) full-length recombinant protein with GST tag.
Immunogen sequence/protein sequence: MEKGPVRAPAEKPRGARCSNGFPERDPPRPGPSRPAEKPPRPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS
Protein accession: AAH25415.1
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002643-A02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (53.61 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Related products: - GCH1 purified MaxPab mouse polyclonal antibody (B01P)
- GCH1 purified MaxPab rabbit polyclonal antibody (D01P)
- GCHFR purified MaxPab rabbit polyclonal antibody (D01P)
- GCK purified MaxPab mouse polyclonal antibody (B01P)
- GCK purified MaxPab mouse polyclonal antibody (B02P)
Shipping condition: Dry Ice

Buy GCH1 polyclonal antibody (A02) now

Add to cart