Login to display prices
Login to display prices
GCH1 polyclonal antibody (A01) View larger

GCH1 polyclonal antibody (A01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GCH1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesMouse
ApplicationsELISA,WB-Re

More info about GCH1 polyclonal antibody (A01)

Reference: H00002643-A01
Product name: GCH1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant GCH1.
Gene id: 2643
Gene name: GCH1
Gene alias: DYT14|DYT5|GCH|GTP-CH-1|GTPCH1
Gene description: GTP cyclohydrolase 1
Genbank accession: NM_000161
Immunogen: GCH1 (NP_000152, 84 a.a. ~ 172 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: ENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIV
Protein accession: NP_000152
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: