GCG (Human) Recombinant Protein (P01) View larger

GCG (Human) Recombinant Protein (P01)

New product

374,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GCG (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about GCG (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00002641-P01
Product name: GCG (Human) Recombinant Protein (P01)
Product description: Human GCG full-length ORF ( AAH05278, 1 a.a. - 180 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 2641
Gene name: GCG
Gene alias: GLP1|GLP2|GRPP
Gene description: glucagon
Genbank accession: BC005278
Immunogen sequence/protein sequence: MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
Protein accession: AAH05278
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00002641-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Related products: - GCH1 (Human) Recombinant Protein (P01)
- GCH1 (Human) Recombinant Protein (Q01)
- GCHFR (Human) Recombinant Protein (P01)
- GCHFR (Human) Recombinant Protein (Q01)
- GCK (Human) Recombinant Protein (P01)
Shipping condition: Dry Ice

Buy GCG (Human) Recombinant Protein (P01) now

Add to cart