GCG monoclonal antibody (M02), clone 1E2-E6 View larger

GCG monoclonal antibody (M02), clone 1E2-E6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GCG monoclonal antibody (M02), clone 1E2-E6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about GCG monoclonal antibody (M02), clone 1E2-E6

Brand: Abnova
Reference: H00002641-M02
Product name: GCG monoclonal antibody (M02), clone 1E2-E6
Product description: Mouse monoclonal antibody raised against a full length recombinant GCG.
Clone: 1E2-E6
Isotype: IgG1 Kappa
Gene id: 2641
Gene name: GCG
Gene alias: GLP1|GLP2|GRPP
Gene description: glucagon
Genbank accession: BC005278
Immunogen: GCG (AAH05278, 1 a.a. ~ 180 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
Protein accession: AAH05278
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002641-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (45.54 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002641-M02-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged GCG is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Related products: - GCH1 monoclonal antibody (M01), clone 4A12
- GCH1 monoclonal antibody (M02), clone 2C4
- GCH1 monoclonal antibody (M03), clone 1F5
- GCHFR monoclonal antibody (M01), clone 4G6
- GCK monoclonal antibody (M01), clone 3C7
Shipping condition: Dry Ice

Buy GCG monoclonal antibody (M02), clone 1E2-E6 now

Add to cart