Login to display prices
Login to display prices
GCG monoclonal antibody (M01), clone 2D3-2B11 View larger

GCG monoclonal antibody (M01), clone 2D3-2B11

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GCG monoclonal antibody (M01), clone 2D3-2B11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about GCG monoclonal antibody (M01), clone 2D3-2B11

Reference: H00002641-M01
Product name: GCG monoclonal antibody (M01), clone 2D3-2B11
Product description: Mouse monoclonal antibody raised against a full length recombinant GCG.
Clone: 2D3-2B11
Isotype: IgG1 Kappa
Gene id: 2641
Gene name: GCG
Gene alias: GLP1|GLP2|GRPP
Gene description: glucagon
Genbank accession: BC005278
Immunogen: GCG (AAH05278, 1 a.a. ~ 180 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
Protein accession: AAH05278
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: