Login to display prices
Login to display prices
GCG purified MaxPab rabbit polyclonal antibody (D01P) View larger

GCG purified MaxPab rabbit polyclonal antibody (D01P)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GCG purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
ClonalityPolyclonal
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about GCG purified MaxPab rabbit polyclonal antibody (D01P)

Reference: H00002641-D01P
Product name: GCG purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human GCG protein.
Gene id: 2641
Gene name: GCG
Gene alias: GLP1|GLP2|GRPP
Gene description: glucagon
Genbank accession: NM_002054
Immunogen: GCG (NP_002045.1, 1 a.a. ~ 180 a.a) full-length human protein.
Immunogen sequence/protein sequence: MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
Protein accession: NP_002045.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Shipping condition: Dry Ice

30 other products in the same category: