GCG purified MaxPab rabbit polyclonal antibody (D01P) View larger

GCG purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GCG purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about GCG purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00002641-D01P
Product name: GCG purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human GCG protein.
Gene id: 2641
Gene name: GCG
Gene alias: GLP1|GLP2|GRPP
Gene description: glucagon
Genbank accession: NM_002054
Immunogen: GCG (NP_002045.1, 1 a.a. ~ 180 a.a) full-length human protein.
Immunogen sequence/protein sequence: MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
Protein accession: NP_002045.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00002641-D01P-13-15-1.jpg
Application image note: Western Blot analysis of GCG expression in transfected 293T cell line (H00002641-T01) by GCG MaxPab polyclonal antibody.

Lane 1: GCG transfected lysate(20.90 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Related products: - GCH1 polyclonal antibody (A01)
- GCH1 polyclonal antibody (A02)
- GCH1 purified MaxPab mouse polyclonal antibody (B01P)
- GCH1 purified MaxPab rabbit polyclonal antibody (D01P)
- GCHFR purified MaxPab rabbit polyclonal antibody (D01P)
Shipping condition: Dry Ice

Buy GCG purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart