Login to display prices
Login to display prices
GCG polyclonal antibody (A01) View larger

GCG polyclonal antibody (A01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GCG polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesMouse
ApplicationsELISA,WB-Re

More info about GCG polyclonal antibody (A01)

Reference: H00002641-A01
Product name: GCG polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a full-length recombinant GCG.
Gene id: 2641
Gene name: GCG
Gene alias: GLP1|GLP2|GRPP
Gene description: glucagon
Genbank accession: BC005278
Immunogen: GCG (AAH05278, 1 a.a. ~ 180 a.a) full-length recombinant protein with GST tag.
Immunogen sequence/protein sequence: MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
Protein accession: AAH05278
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: