GBX2 monoclonal antibody (M09), clone 4B11 View larger

GBX2 monoclonal antibody (M09), clone 4B11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GBX2 monoclonal antibody (M09), clone 4B11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA

More info about GBX2 monoclonal antibody (M09), clone 4B11

Brand: Abnova
Reference: H00002637-M09
Product name: GBX2 monoclonal antibody (M09), clone 4B11
Product description: Mouse monoclonal antibody raised against a full-length recombinant GBX2.
Clone: 4B11
Isotype: IgG2a Kappa
Gene id: 2637
Gene name: GBX2
Gene alias: -
Gene description: gastrulation brain homeobox 2
Genbank accession: NM_001485
Immunogen: GBX2 (NP_001476, 141 a.a. ~ 230 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEE*
Protein accession: NP_001476
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00002637-M09-1-8-1.jpg
Application image note: GBX2 monoclonal antibody (M09), clone 4B11 Western Blot analysis of GBX2 expression in NIH/3T3 ( Cat # L018V1 ).
Applications: WB-Ce,S-ELISA,ELISA
Related products: - GBX2 monoclonal antibody (M10), clone 2A9
- GBX2 monoclonal antibody (M20), clone 4B1
- GCG monoclonal antibody (M01), clone 2D3-2B11
- GCG monoclonal antibody (M02), clone 1E2-E6
- GCH1 monoclonal antibody (M01), clone 4A12
Shipping condition: Dry Ice

Buy GBX2 monoclonal antibody (M09), clone 4B11 now

Add to cart