GBX2 monoclonal antibody (M04), clone 1C11 View larger

GBX2 monoclonal antibody (M04), clone 1C11

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GBX2 monoclonal antibody (M04), clone 1C11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA

More info about GBX2 monoclonal antibody (M04), clone 1C11

Brand: Abnova
Reference: H00002637-M04
Product name: GBX2 monoclonal antibody (M04), clone 1C11
Product description: Mouse monoclonal antibody raised against a partial recombinant GBX2.
Clone: 1C11
Isotype: IgG2b Kappa
Gene id: 2637
Gene name: GBX2
Gene alias: -
Gene description: gastrulation brain homeobox 2
Genbank accession: NM_001485
Immunogen: GBX2 (NP_001476, 114 a.a. ~ 182 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ASPQHQEAAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQG
Protein accession: NP_001476
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002637-M04-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to GBX2 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA
Related products: - GBX2 monoclonal antibody (M08), clone 3B6
- GBX2 monoclonal antibody (M09), clone 4B11
- GBX2 monoclonal antibody (M10), clone 2A9
- GBX2 monoclonal antibody (M20), clone 4B1
- GCG monoclonal antibody (M01), clone 2D3-2B11
Shipping condition: Dry Ice

Buy GBX2 monoclonal antibody (M04), clone 1C11 now

Add to cart