Login to display prices
Login to display prices
GBX2 monoclonal antibody (M04), clone 1C11 View larger

GBX2 monoclonal antibody (M04), clone 1C11

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GBX2 monoclonal antibody (M04), clone 1C11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsIF,ELISA

More info about GBX2 monoclonal antibody (M04), clone 1C11

Reference: H00002637-M04
Product name: GBX2 monoclonal antibody (M04), clone 1C11
Product description: Mouse monoclonal antibody raised against a partial recombinant GBX2.
Clone: 1C11
Isotype: IgG2b Kappa
Gene id: 2637
Gene name: GBX2
Gene alias: -
Gene description: gastrulation brain homeobox 2
Genbank accession: NM_001485
Immunogen: GBX2 (NP_001476, 114 a.a. ~ 182 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ASPQHQEAAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQG
Protein accession: NP_001476
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: