GBX2 monoclonal antibody (M02), clone 2D8 View larger

GBX2 monoclonal antibody (M02), clone 2D8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GBX2 monoclonal antibody (M02), clone 2D8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IF,S-ELISA,ELISA,WB-Re

More info about GBX2 monoclonal antibody (M02), clone 2D8

Brand: Abnova
Reference: H00002637-M02
Product name: GBX2 monoclonal antibody (M02), clone 2D8
Product description: Mouse monoclonal antibody raised against a partial recombinant GBX2.
Clone: 2D8
Isotype: IgG2a Kappa
Gene id: 2637
Gene name: GBX2
Gene alias: -
Gene description: gastrulation brain homeobox 2
Genbank accession: NM_001485
Immunogen: GBX2 (NP_001476, 114 a.a. ~ 182 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ASPQHQEAAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQG
Protein accession: NP_001476
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002637-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.7 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002637-M02-2-E7-1.jpg
Application image note: GBX2 monoclonal antibody (M02), clone 2D8. Western Blot analysis of GBX2 expression in human parotid gland.
Applications: WB-Ti,IF,S-ELISA,ELISA,WB-Re
Related products: - GBX2 monoclonal antibody (M03), clone 1A7
- GBX2 monoclonal antibody (M04), clone 1C11
- GBX2 monoclonal antibody (M08), clone 3B6
- GBX2 monoclonal antibody (M09), clone 4B11
- GBX2 monoclonal antibody (M10), clone 2A9
Shipping condition: Dry Ice

Buy GBX2 monoclonal antibody (M02), clone 2D8 now

Add to cart