No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,IF,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00002637-M01 |
| Product name: | GBX2 monoclonal antibody (M01), clone 2A4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GBX2. |
| Clone: | 2A4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2637 |
| Gene name: | GBX2 |
| Gene alias: | - |
| Gene description: | gastrulation brain homeobox 2 |
| Genbank accession: | NM_001485 |
| Immunogen: | GBX2 (NP_001476, 114 a.a. ~ 182 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ASPQHQEAAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQG |
| Protein accession: | NP_001476 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.7 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | GBX2 monoclonal antibody (M01), clone 2A4. Western Blot analysis of GBX2 expression in human parotid gland. |
| Applications: | WB-Ti,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Human iPSC-Derived Cerebellar Neurons from a Patient with Ataxia-Telangiectasia Reveal Disrupted Gene Regulatory Networks.Nayler SP, Powell JE, Vanichkina DP, Korn O, Wells CA, Kanjhan R, Sun J, Taft RJ, Lavin MF, Wolvetang EJ. Front Cell Neurosci. 2017 Oct 13;11:321. |