GBX2 monoclonal antibody (M01), clone 2A4 View larger

GBX2 monoclonal antibody (M01), clone 2A4

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GBX2 monoclonal antibody (M01), clone 2A4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IF,S-ELISA,ELISA,WB-Re

More info about GBX2 monoclonal antibody (M01), clone 2A4

Brand: Abnova
Reference: H00002637-M01
Product name: GBX2 monoclonal antibody (M01), clone 2A4
Product description: Mouse monoclonal antibody raised against a partial recombinant GBX2.
Clone: 2A4
Isotype: IgG2a Kappa
Gene id: 2637
Gene name: GBX2
Gene alias: -
Gene description: gastrulation brain homeobox 2
Genbank accession: NM_001485
Immunogen: GBX2 (NP_001476, 114 a.a. ~ 182 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ASPQHQEAAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQG
Protein accession: NP_001476
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002637-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.7 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002637-M01-2-E7-1.jpg
Application image note: GBX2 monoclonal antibody (M01), clone 2A4. Western Blot analysis of GBX2 expression in human parotid gland.
Applications: WB-Ti,IF,S-ELISA,ELISA,WB-Re
Related products: - GBX2 monoclonal antibody (M02), clone 2D8
- GBX2 monoclonal antibody (M03), clone 1A7
- GBX2 monoclonal antibody (M04), clone 1C11
- GBX2 monoclonal antibody (M08), clone 3B6
- GBX2 monoclonal antibody (M09), clone 4B11
Shipping condition: Dry Ice
Publications: Human iPSC-Derived Cerebellar Neurons from a Patient with Ataxia-Telangiectasia Reveal Disrupted Gene Regulatory Networks.Nayler SP, Powell JE, Vanichkina DP, Korn O, Wells CA, Kanjhan R, Sun J, Taft RJ, Lavin MF, Wolvetang EJ.
Front Cell Neurosci. 2017 Oct 13;11:321.

Buy GBX2 monoclonal antibody (M01), clone 2A4 now

Add to cart