No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00002628-M08A |
Product name: | GATM monoclonal antibody (M08A), clone 2H7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GATM. |
Clone: | 2H7 |
Isotype: | IgM Kappa |
Gene id: | 2628 |
Gene name: | GATM |
Gene alias: | AGAT|AT |
Gene description: | glycine amidinotransferase (L-arginine:glycine amidinotransferase) |
Genbank accession: | NM_001482 |
Immunogen: | GATM (NP_001473.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MLRVRCLRGGSRGAEAVHYIGSRLGRTLTGWVQRTFQSTQAATASSRNSCAADDKATEPLPKDCPVSSYNEWDPLEEVIVGRAENACVPPFTIEVKANTY |
Protein accession: | NP_001473.1 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |