| Brand: | Abnova |
| Reference: | H00002624-M05A |
| Product name: | GATA2 monoclonal antibody (M05A), clone 1A5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GATA2. |
| Clone: | 1A5 |
| Isotype: | IgG |
| Gene id: | 2624 |
| Gene name: | GATA2 |
| Gene alias: | MGC2306|NFE1B |
| Gene description: | GATA binding protein 2 |
| Genbank accession: | BC018988 |
| Immunogen: | GATA2 (AAH18988, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGK |
| Protein accession: | AAH18988 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.96 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | GATA2 monoclonal antibody (M05A), clone 1A5 Western Blot analysis of GATA2 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |