| Brand: | Abnova |
| Reference: | H00002620-A01 |
| Product name: | GAS2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant GAS2. |
| Gene id: | 2620 |
| Gene name: | GAS2 |
| Gene alias: | MGC32610 |
| Gene description: | growth arrest-specific 2 |
| Genbank accession: | NM_005256 |
| Immunogen: | GAS2 (NP_005247, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEKLDNGALLCQLAETMQEKFKESMDANKPTKNLPLKKIPCKTSAPSGSFFAR |
| Protein accession: | NP_005247 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Gene silencing in cancer by histone H3 lysine 27 trimethylation independent of promoter DNA methylation.Kondo Y, Shen L, Cheng AS, Ahmed S, Boumber Y, Charo C, Yamochi T, Urano T, Furukawa K, Kwabi-Addo B, Gold DL, Sekido Y, Huang TH, Issa JP. Nat Genet. 2008 Jun;40(6):741-50. Epub 2008 May 18. |