Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GAPDH monoclonal antibody (M01), clone 3C2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about GAPDH monoclonal antibody (M01), clone 3C2
| Brand: | Abnova |
| Reference: | H00002597-M01 |
| Product name: | GAPDH monoclonal antibody (M01), clone 3C2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GAPDH. |
| Clone: | 3C2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2597 |
| Gene name: | GAPDH |
| Gene alias: | G3PD|GAPD|MGC88685 |
| Gene description: | glyceraldehyde-3-phosphate dehydrogenase |
| Genbank accession: | NM_002046 |
| Immunogen: | GAPDH (NP_002037, 226 a.a. ~ 335 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE |
| Protein accession: | NP_002037 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | GAPDH monoclonal antibody (M01), clone 3C2 Western Blot analysis of GAPDH expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Reticulon 3 interacts with NS4B of the hepatitis C virus and negatively regulates viral replication by disrupting NS4B self-interaction.Wu MJ, Ke PY, Hsu JT, Yeh CT, Horng JT Cell Microbiol. 2014 Jun 4. doi: 10.1111/cmi.12318. |