No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse,Rat |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00002597-M01 |
Product name: | GAPDH monoclonal antibody (M01), clone 3C2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GAPDH. |
Clone: | 3C2 |
Isotype: | IgG1 Kappa |
Gene id: | 2597 |
Gene name: | GAPDH |
Gene alias: | G3PD|GAPD|MGC88685 |
Gene description: | glyceraldehyde-3-phosphate dehydrogenase |
Genbank accession: | NM_002046 |
Immunogen: | GAPDH (NP_002037, 226 a.a. ~ 335 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE |
Protein accession: | NP_002037 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![]() |
Application image note: | GAPDH monoclonal antibody (M01), clone 3C2 Western Blot analysis of GAPDH expression in A-431 ( Cat # L015V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Reticulon 3 interacts with NS4B of the hepatitis C virus and negatively regulates viral replication by disrupting NS4B self-interaction.Wu MJ, Ke PY, Hsu JT, Yeh CT, Horng JT Cell Microbiol. 2014 Jun 4. doi: 10.1111/cmi.12318. |