No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00002597-A01 |
Product name: | GAPDH polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant GAPDH. |
Gene id: | 2597 |
Gene name: | GAPDH |
Gene alias: | G3PD|GAPD|MGC88685 |
Gene description: | glyceraldehyde-3-phosphate dehydrogenase |
Genbank accession: | NM_002046 |
Immunogen: | GAPDH (NP_002037, 226 a.a. ~ 335 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | GKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE |
Protein accession: | NP_002037 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Cyclic compression-induced p38 activation and subsequent MMP13 expression requires Rho/ROCK activity in bovine cartilage explants.Nakagawa K, Teramura T, Takehara T, Onodera Y, Hamanishi C, Akagi M, Fukuda K. Inflamm Res. 2012 Jun 12. |