No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Rat |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00002583-M02 |
Product name: | B4GALNT1 monoclonal antibody (M02), clone 5F9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant B4GALNT1. |
Clone: | 5F9 |
Isotype: | IgG2a Kappa |
Gene id: | 2583 |
Gene name: | B4GALNT1 |
Gene alias: | GALGT|GALNACT |
Gene description: | beta-1,4-N-acetyl-galactosaminyl transferase 1 |
Genbank accession: | NM_001478 |
Immunogen: | B4GALNT1 (NP_001469, 30 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | APGLRLPLAPWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQEFQAFLS |
Protein accession: | NP_001469 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: | ![]() |
Application image note: | B4GALNT1 monoclonal antibody (M02), clone 5F9 Western Blot analysis of B4GALNT1 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |