Cart 85 Product Products 27 951,13 € (empty)
No products
To be determined Shipping
27 951,13 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 85 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 27 951,13 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 27 951,13 €
Data sheet of B4GALNT1 monoclonal antibody (M02), clone 5F9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about B4GALNT1 monoclonal antibody (M02), clone 5F9
| Brand: | Abnova |
| Reference: | H00002583-M02 |
| Product name: | B4GALNT1 monoclonal antibody (M02), clone 5F9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant B4GALNT1. |
| Clone: | 5F9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2583 |
| Gene name: | B4GALNT1 |
| Gene alias: | GALGT|GALNACT |
| Gene description: | beta-1,4-N-acetyl-galactosaminyl transferase 1 |
| Genbank accession: | NM_001478 |
| Immunogen: | B4GALNT1 (NP_001469, 30 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | APGLRLPLAPWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQEFQAFLS |
| Protein accession: | NP_001469 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | B4GALNT1 monoclonal antibody (M02), clone 5F9 Western Blot analysis of B4GALNT1 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |