| Brand: | Abnova |
| Reference: | H00002580-M01 |
| Product name: | GAK monoclonal antibody (M01), clone 4C10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GAK. |
| Clone: | 4C10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2580 |
| Gene name: | GAK |
| Gene alias: | FLJ16629|FLJ40395|MGC99654 |
| Gene description: | cyclin G associated kinase |
| Genbank accession: | BC008668 |
| Immunogen: | GAK (AAH08668, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SAVAPTPATEGPLFSPGGQPAPCGSQASWTKSQNPDPFADLGDLSSGLQGSPAGFPPGGFIPKTATTPKGSSSWQTSRPPAQGASWPPQAKPPPKACTQP |
| Protein accession: | AAH08668 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | GAK monoclonal antibody (M01), clone 4C10 Western Blot analysis of GAK expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |