No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00002564-M01 |
Product name: | GABRE monoclonal antibody (M01), clone 1G11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GABRE. |
Clone: | 1G11 |
Isotype: | IgG2a Kappa |
Gene id: | 2564 |
Gene name: | GABRE |
Gene alias: | - |
Gene description: | gamma-aminobutyric acid (GABA) A receptor, epsilon |
Genbank accession: | BC059376.1 |
Immunogen: | GABRE (AAH59376.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MLSKVLPVFLGILLILQSRVEGPQTESKNEASSRDVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILNTILSNYDHKLRPGIGEKPTVVTVE |
Protein accession: | AAH59376.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | GABRE monoclonal antibody (M01), clone 1G11. Western Blot analysis of GABRE expression in Jurkat. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |