Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GAB1 monoclonal antibody (M01), clone 1B3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,ELISA,WB-Re,PLA-Ce |
More info about GAB1 monoclonal antibody (M01), clone 1B3
| Brand: | Abnova |
| Reference: | H00002549-M01 |
| Product name: | GAB1 monoclonal antibody (M01), clone 1B3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GAB1. |
| Clone: | 1B3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2549 |
| Gene name: | GAB1 |
| Gene alias: | - |
| Gene description: | GRB2-associated binding protein 1 |
| Genbank accession: | NM_207123 |
| Immunogen: | GAB1 (NP_997006, 625 a.a. ~ 724 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NLSSEDPNLFGSNSLDGGSSPMIKPKGDKQVEYLDLDLDSGKSTPPRKQKSSGSGSSVADERVDYVVVDQQKTLALKSTREAWTDGRQSTESETPPKSVK |
| Protein accession: | NP_997006 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Proximity Ligation Analysis of protein-protein interactions between CRKL and GAB1. Mahlavu cells were stained with anti-CRKL rabbit purified polyclonal 1:1200 and anti-GAB1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
| Applications: | IF,ELISA,WB-Re,PLA-Ce |
| Shipping condition: | Dry Ice |
| Publications: | Dramatic Response to Crizotinib in a Patient with Lung Cancer Positive for an HLA-DRB1-MET Gene Fusion.Davies KD, Ng TL, Estrada-Bernal A, Le AT, Ennever PR, Camidge DR, Doebele RC, Aisner DL. JCO Precis Oncol. 2017;2017(1). doi: 10.1200/PO.17.00117. Epub 2017 Aug 29. |