Brand: | Abnova |
Reference: | H00002542-M01 |
Product name: | SLC37A4 monoclonal antibody (M01), clone 7B9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC37A4. |
Clone: | 7B9 |
Isotype: | IgG2a Kappa |
Gene id: | 2542 |
Gene name: | SLC37A4 |
Gene alias: | G6PT1|G6PT2|G6PT3|GSD1b|GSD1c|GSD1d|MGC15729|PRO0685|TRG19 |
Gene description: | solute carrier family 37 (glucose-6-phosphate transporter), member 4 |
Genbank accession: | NM_001467 |
Immunogen: | SLC37A4 (NP_001458.1, 28 a.a. ~ 76 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RKTFSFVMPSLVEEIPLDKDDLGFITSSQSAAYAISKFVSGVLSDQMSA |
Protein accession: | NP_001458.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (31.13 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SLC37A4 is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |